CacheBy
Atlas Antibodies Anti-BRWD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRWD1 Antibody

상품 한눈에 보기

Human BRWD1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. 인체 시료 IHC 등 다양한 연구 응용에 적합. 40% glycerol 및 PBS buffer로 안정화 처리됨.

카탈로그번호
HPA030944-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030944-100 Anti-BRWD1 Antibody, bromodomain and WD repeat domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030944-25 Anti-BRWD1 Antibody, bromodomain and WD repeat domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRWD1 Antibody

Anti-BRWD1 Antibody

Target Protein: bromodomain and WD repeat domain containing 1
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal Antibody against Human BRWD1


Alternative Gene Names

C21orf107, FLJ11315, N143, WDR9

Open Datasheet


Target Information

항목 내용
Target Protein bromodomain and WD repeat domain containing 1
Target Gene BRWD1
Verified Species Reactivity Human
Interspecies Identity Rat (57%), Mouse (53%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

SHIPGSETDRTFSSESTLAQKATAENNFEVELNYGLRRWNGRRLRTYGKAPFSKTKVIHDSQETAEKEVKRKRSHPELENVKISETTG

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.