Atlas Antibodies Anti-BSDC1 Antibody

상품 한눈에 보기

인간 BSDC1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. IHC, WB, ICC 등 다양한 응용에 적합하며 PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증되었으며 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031358-100 Anti-BSDC1 Antibody, BSD domain containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031358-25 Anti-BSDC1 Antibody, BSD domain containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

BSD domain containing 1

Immunohistochemistry (IHC)
Western Blot (WB)
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Immunocytochemistry (ICC)

Polyclonal Antibody against Human BSDC1

FLJ10276, RP4-811H24.7

항목	내용
Target Protein	BSD domain containing 1
Target Gene	BSDC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	DLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGEVSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCL

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000040859	61%
Rat	ENSRNOG00000008338	60%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand