CacheBy
Atlas Antibodies Anti-BRWD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRWD1 Antibody

상품 한눈에 보기

Human BRWD1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증되었으며, 보존용으로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA030943-100 Anti-BRWD1 Antibody, bromodomain and WD repeat domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030943-25 Anti-BRWD1 Antibody, bromodomain and WD repeat domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRWD1 Antibody

Anti-BRWD1 Antibody

Target: bromodomain and WD repeat domain containing 1 (BRWD1)
Type: Polyclonal Antibody against Human BRWD1


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against Human BRWD1 protein.


Alternative Gene Names

C21orf107, FLJ11315, N143, WDR9

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein bromodomain and WD repeat domain containing 1
Target Gene BRWD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SHIPGSETDRTFSSESTLAQKATAENNFEVELNYGLRRWNGRRLRTYGKAPFSKTKVIHDSQETAEKEVKRKRSHPELENVKISETTG
Verified Species Reactivity Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000001632 (57%)
  • Mouse ENSMUSG00000022914 (53%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.