CacheBy
Atlas Antibodies Anti-BRSK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRSK1 Antibody

상품 한눈에 보기

Human BRSK1 단백질을 인식하는 토끼 유래 폴리클로날 항체. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종간 반응성(마우스, 랫트 100%)을 보유. 안정적인 PBS/glycerol buffer에 보존됨.

카탈로그번호
HPA061719-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061719-100 Anti-BRSK1 Antibody, BR serine/threonine kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061719-25 Anti-BRSK1 Antibody, BR serine/threonine kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRSK1 Antibody

Anti-BRSK1 Antibody

Target: BR serine/threonine kinase 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human BRSK1.


Alternative Gene Names

  • KIAA1811

Open Datasheet


Target Information

항목 내용
Target Protein BR serine/threonine kinase 1
Target Gene BRSK1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VEPEKRLSLEQIQKHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPD
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000035390 (100%), Rat ENSRNOG00000017673 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.