
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BRD2 Antibody
상품 한눈에 보기
Human BRD2 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation으로 RNA-seq 데이터와 비교 검증 완료. Affinity purification으로 높은 특이성과 재현성 보장.
- 카탈로그번호
- HPA042816-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042816-100 Anti-BRD2 Antibody, bromodomain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042816-25 Anti-BRD2 Antibody, bromodomain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BRD2 Antibody
Anti-BRD2 Antibody
Target: bromodomain containing 2 (BRD2)
Type: Rabbit Polyclonal Antibody
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Orthogonal validation)
- Immunocytochemistry (ICC)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human BRD2
Alternative Gene Names
D6S113E, FSRG1, KIAA9001, NAT, RING3
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Sequence:
SMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHSAGP
Species Reactivity
- Verified Species: Human
- Interspecies Identity:
- Mouse ENSMUSG00000024335 (99%)
- Rat ENSRNOG00000000461 (99%)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| MSDS | Material Safety Data Sheet |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



