
Atlas Antibodies Anti-BPNT1 Antibody
상품 한눈에 보기
Human BPNT1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% glycerol/PBS buffer에 보존됩니다. 인간에 대해 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BPNT1 Antibody
Target Information
- Target Protein: 3
(2), 5`-bisphosphate nucleotidase 1 - Target Gene: BPNT1
- Verified Species Reactivity: Human
- Interspecies Identity:
- Mouse ENSMUSG00000026617 (94%)
- Rat ENSRNOG00000002378 (92%)
Product Description
- Type: Polyclonal Antibody against Human BPNT1
- Host: Rabbit
- Isotype: IgG
- Purification Method: Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
SEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPBuffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Preservative | 0.02% sodium azide |
| Safety Info | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BPIFB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BPIFC Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BPNT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BPIFB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BPTF Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.