CacheBy
Atlas Antibodies Anti-BOLA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BOLA2 Antibody

상품 한눈에 보기

Human BOLA2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤과 PBS 완충액에 보존.

카탈로그번호
HPA045380-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045380-100 Anti-BOLA2 Antibody, bolA family member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045380-25 Anti-BOLA2 Antibody, bolA family member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BOLA2 Antibody

Anti-BOLA2 Antibody

Target Information

  • Target Protein: bolA family member 2
  • Target Gene: BOLA2
  • Alternative Gene Names: BOLA2A, My016

Product Description

Polyclonal antibody against Human BOLA2.

  • Immunohistochemistry (IHC)
    (이미지 텍스트: IHC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000014275 33%
Mouse ENSMUSG00000019254 28%

Clonality and Host

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.