Atlas Antibodies Anti-BOD1L1 Antibody

상품 한눈에 보기

인간 BOD1L1 단백질을 표적으로 하는 폴리클로날 항체로, 세포 분열 시 염색체의 양방향성 연구에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. IHC 등 다양한 응용에 사용 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036943-100 Anti-BOD1L1 Antibody, biorientation of chromosomes in cell division 1-like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036943-25 Anti-BOD1L1 Antibody, biorientation of chromosomes in cell division 1-like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: biorientation of chromosomes in cell division 1-like 1 (BOD1L1)
Supplier: Atlas Antibodies

면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.

Polyclonal antibody against human BOD1L1.

BOD1L, FAM44A, FLJ33215, KIAA1327

항목	내용
Target Protein	biorientation of chromosomes in cell division 1-like 1
Target Gene	BOD1L1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000050437 (84%), Mouse ENSMUSG00000061755 (79%)

Antigen Sequence:
SDSMEEGEITSDDEEKNKQNKTKTQTSDSSEGKTKSVRHAYVHKPYLYSKYYSDSDDELTVEQRRQSIGILWF

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)