CacheBy
Atlas Antibodies Anti-BLVRA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BLVRA Antibody

상품 한눈에 보기

Human BLVRA를 인식하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit 유래 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. PBS와 글리세롤 버퍼에 보존되어 있으며, Human에 대해 검증되었습니다.

카탈로그번호
HPA054322-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054322-100 Anti-BLVRA Antibody, biliverdin reductase A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054322-25 Anti-BLVRA Antibody, biliverdin reductase A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BLVRA Antibody

Anti-BLVRA Antibody

Target Information

  • Target Protein: Biliverdin reductase A
  • Target Gene: BLVRA
  • Alternative Gene Names: BLVR
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human BLVRA.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000001999 86%
Rat ENSRNOG00000011778 85%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Information

Open Datasheet

제품 이미지

Recommended for WB
Recommended for ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.