AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BLOC1S1 Antibody
상품 한눈에 보기
Human BLOC1S1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. 고순도 친화정제 방식으로 제조되었으며, 인간, 랫, 마우스에 교차 반응. 안정한 PBS/glycerol buffer에 보존됨.
- 카탈로그번호
- HPA021381-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021381-100 Anti-BLOC1S1 Antibody, biogenesis of lysosomal organelles complex-1, subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021381-25 Anti-BLOC1S1 Antibody, biogenesis of lysosomal organelles complex-1, subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BLOC1S1 Antibody
Anti-BLOC1S1 Antibody
Target: Biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1)
Type: Polyclonal Antibody against Human BLOC1S1
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody generated in rabbit against human BLOC1S1 protein.
Alternative gene names: BLOS1, GCN5L1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Biogenesis of lysosomal organelles complex-1, subunit 1 |
| Target Gene | BLOC1S1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Amino Acid Sequence | LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Rat (ENSRNOG00000007784) | 100% identity |
| Mouse (ENSMUSG00000090247) | 99% identity |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol, PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.