CacheBy
Atlas Antibodies Anti-BLOC1S1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BLOC1S1 Antibody

상품 한눈에 보기

Human BLOC1S1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. 고순도 친화정제 방식으로 제조되었으며, 인간, 랫, 마우스에 교차 반응. 안정한 PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA021381-100 Anti-BLOC1S1 Antibody, biogenesis of lysosomal organelles complex-1, subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021381-25 Anti-BLOC1S1 Antibody, biogenesis of lysosomal organelles complex-1, subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BLOC1S1 Antibody

Anti-BLOC1S1 Antibody

Target: Biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1)
Type: Polyclonal Antibody against Human BLOC1S1


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody generated in rabbit against human BLOC1S1 protein.
Alternative gene names: BLOS1, GCN5L1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Biogenesis of lysosomal organelles complex-1, subunit 1
Target Gene BLOC1S1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Amino Acid Sequence LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ

Species Reactivity

반응성
Human Verified
Rat (ENSRNOG00000007784) 100% identity
Mouse (ENSMUSG00000090247) 99% identity

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer Composition 40% glycerol, PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.