
Atlas Antibodies Anti-BLOC1S1 Antibody
상품 한눈에 보기
Human BLOC1S1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합. 고순도 친화정제 방식으로 제조되었으며, 인간, 랫, 마우스에 교차 반응. 안정한 PBS/glycerol buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BLOC1S1 Antibody
Target: Biogenesis of lysosomal organelles complex-1, subunit 1 (BLOC1S1)
Type: Polyclonal Antibody against Human BLOC1S1
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody generated in rabbit against human BLOC1S1 protein.
Alternative gene names: BLOS1, GCN5L1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Biogenesis of lysosomal organelles complex-1, subunit 1 |
| Target Gene | BLOC1S1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Amino Acid Sequence | LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Rat (ENSRNOG00000007784) | 100% identity |
| Mouse (ENSMUSG00000090247) | 99% identity |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol, PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BLOC1S2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BLNK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BLOC1S1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BLMH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BLM Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.