
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PCNA Antibody
상품 한눈에 보기
인간 PCNA 단백질을 타겟으로 한 토끼 폴리클로날 항체. IHC 및 WB에서 정교한 단백질 발현 검증에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 사람, 마우스, 랫트에 반응.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA030522-100 Anti-PCNA Antibody, proliferating cell nuclear antigen 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030522-25 Anti-PCNA Antibody, proliferating cell nuclear antigen 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PCNA Antibody
Anti-PCNA Antibody
Target: Proliferating Cell Nuclear Antigen (PCNA)
Type: Polyclonal Antibody against Human PCNA
Recommended Applications
IHC (Orthogonal Validation):
Orthogonal validation of protein expression using immunohistochemistry (IHC) by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Independent Validation):
Validation of protein expression in Western blot by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human PCNA, validated for use in IHC and WB.
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Proliferating Cell Nuclear Antigen |
| Target Gene | PCNA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027342 (98%), Rat ENSRNOG00000021264 (98%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



