Atlas Antibodies Anti-PCNA Antibody
인간 PCNA 단백질을 타겟으로 한 토끼 폴리클로날 항체. IHC 및 WB에서 정교한 단백질 발현 검증에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 사람, 마우스, 랫트에 반응.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PCNA Antibody
Target: Proliferating Cell Nuclear Antigen (PCNA)
Type: Polyclonal Antibody against Human PCNA
Recommended Applications
IHC (Orthogonal Validation):
Orthogonal validation of protein expression using immunohistochemistry (IHC) by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Independent Validation):
Validation of protein expression in Western blot by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human PCNA, validated for use in IHC and WB.
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Proliferating Cell Nuclear Antigen |
| Target Gene | PCNA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027342 (98%), Rat ENSRNOG00000021264 (98%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|