Atlas Antibodies Anti-PCNA Antibody

상품 한눈에 보기

인간 PCNA 단백질을 타겟으로 한 토끼 폴리클로날 항체. IHC 및 WB에서 정교한 단백질 발현 검증에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 사람, 마우스, 랫트에 반응.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030522-100 Anti-PCNA Antibody, proliferating cell nuclear antigen 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030522-25 Anti-PCNA Antibody, proliferating cell nuclear antigen 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Proliferating Cell Nuclear Antigen (PCNA)
Type: Polyclonal Antibody against Human PCNA

IHC (Orthogonal Validation):
Orthogonal validation of protein expression using immunohistochemistry (IHC) by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Independent Validation):
Validation of protein expression in Western blot by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human PCNA, validated for use in IHC and WB.
Affinity purified using the PrEST antigen as affinity ligand.

항목	내용
Target Protein	Proliferating Cell Nuclear Antigen
Target Gene	PCNA
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000027342 (98%), Rat ENSRNOG00000021264 (98%)