
Atlas Antibodies Anti-PCNA Antibody
상품 한눈에 보기
Human PCNA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. Orthogonal 및 Independent validation을 통해 신뢰성 확보. Affinity purification으로 높은 특이도 제공. 다양한 조직에서 PCNA 발현 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PCNA Antibody
Target: Proliferating Cell Nuclear Antigen (PCNA)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 차이를 검증.
- WB (Independent Validation): 서로 다른 에피토프를 인식하는 독립 항체와의 비교를 통해 단백질 발현 검증.
Product Description
Polyclonal antibody against human PCNA.
Open Datasheet
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Proliferating Cell Nuclear Antigen |
| Target Gene | PCNA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000021264 (98%), Mouse ENSMUSG00000027342 (98%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Antigen Sequence
SASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEE제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PCNA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCMTD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCNA Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCMTD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PCMTD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.