Atlas Antibodies Anti-PBK Antibody
| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA005753-100 | Atlas Antibodies HPA005753-100 Anti-PBK Antibody, PDZ binding kinase 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA005753-25 | Atlas Antibodies HPA005753-25 Anti-PBK Antibody, PDZ binding kinase 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-PBK Antibody
PDZ binding kinase
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human PBK
Alternative Gene Names
CT84, FLJ14385, Nori-3, SPK, TOPK
Target Protein
PDZ binding kinase
Target Gene
PBK
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
SSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRP
Verified Species Reactivity
Human, Mouse
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000015308 (94%)
Mouse ENSMUSG00000022033 (91%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|