
Atlas Antibodies Anti-PAWR Antibody
상품 한눈에 보기
인간 PAWR 단백질을 인식하는 폴리클로날 항체로 IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation으로 RNA-seq 데이터 기반 단백질 발현 검증. Rabbit 유래 IgG 항체이며, PrEST 항원으로 정제됨. Human, Mouse, Rat 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PAWR Antibody
PRKC, apoptosis, WT1, regulator
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Orthogonal validation
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human PAWR
Alternative Gene Names
- par-4
- PAR4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | PRKC, apoptosis, WT1, regulator |
| Target Gene | PAWR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
| 종 | Ortholog ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000035873 | 82% |
| Rat | ENSRNOG00000005917 | 78% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
