Atlas Antibodies Anti-PARD3B Antibody

상품 한눈에 보기

Human PARD3B를 인식하는 Rabbit Polyclonal 항체로, 세포 극성 조절 관련 연구에 적합합니다. IHC 및 ICC 응용에 권장되며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며 Rat, Mouse와 높은 상동성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA035283-100 Anti-PARD3B Antibody, par-3 family cell polarity regulator beta 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA035283-25 Anti-PARD3B Antibody, par-3 family cell polarity regulator beta 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: par-3 family cell polarity regulator beta
Host: Rabbit
Clonality: Polyclonal
Recommended Applications: IHC, ICC

Polyclonal Antibody against Human PARD3B.

ALS2CR19, PAR3beta, Par3L

Target Protein: par-3 family cell polarity regulator beta
Target Gene: PARD3B
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:

ARREGFPLYEDDEGRARPSEYDLLWVPGRGPDGNAHNLRFEGMERQYASLPRGGPADPVDYLPAAPRGLYKERELPYYPGAHPMHPPKGSYPRPTELRVADLRYPQ

Verified Reactivity: Human
Interspecies Identity:
- Rat ENSRNOG00000024345 (80%)
- Mouse ENSMUSG00000052062 (76%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.