
Atlas Antibodies Anti-PANX2 Antibody
상품 한눈에 보기
Human PANX2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. Affinity purification 방식으로 고순도 확보. RNA-seq 데이터 기반 단백질 발현 검증에 적합. 40% glycerol 기반 안정화 버퍼 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-PANX2 Antibody
Target: pannexin 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human PANX2.
Alternative Gene Names
hPANX2, PX2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | pannexin 2 |
| Target Gene | PANX2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SNFIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPS |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000055530 (98%)
- Mouse ENSMUSG00000058441 (97%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-PAPD5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PANX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PANX2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PAPD4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-PANK4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.