Atlas Antibodies Anti-PACS1 Antibody

상품 한눈에 보기

Human PACS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. RNA-seq 기반 직교 검증을 통해 단백질 발현을 확인하였으며, 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 40% 글리세롤/PBS 완충액에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038914-100 Anti-PACS1 Antibody, phosphofurin acidic cluster sorting protein 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038914-25 Anti-PACS1 Antibody, phosphofurin acidic cluster sorting protein 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: phosphofurin acidic cluster sorting protein 1 (PACS1)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data across tissues with high and low expression.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human PACS1.

FLJ10209, KIAA1175

항목	내용
Target Protein	phosphofurin acidic cluster sorting protein 1
Target Gene	PACS1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000020350 (97%), Mouse ENSMUSG00000024855 (96%)

Antigen Sequence:
DTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSE

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.