
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ORAOV1 Antibody
상품 한눈에 보기
Human ORAOV1 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Rat, Mouse와 75% 상동성 보유. 안정화된 글리세롤 버퍼에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062696-100 Anti-ORAOV1 Antibody, oral cancer overexpressed 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062696-25 Anti-ORAOV1 Antibody, oral cancer overexpressed 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ORAOV1 Antibody
Anti-ORAOV1 Antibody
Target Protein: oral cancer overexpressed 1 (ORAOV1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human ORAOV1.
Alternative Gene Names
- TAOS1
Target Information
- Target Protein: oral cancer overexpressed 1
- Target Gene: ORAOV1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000020903 (75%)
- Mouse ENSMUSG00000031072 (75%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)
Recommended Applications
- Immunocytochemistry (ICC)
- Additional applications to be optimized by the user
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



