Atlas Antibodies Anti-ORAOV1 Antibody
상품 한눈에 보기
Human ORAOV1 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Rat, Mouse와 75% 상동성 보유. 안정화된 글리세롤 버퍼에 보존.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ORAOV1 Antibody
Target Protein: oral cancer overexpressed 1 (ORAOV1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against Human ORAOV1.
Alternative Gene Names
- TAOS1
Target Information
- Target Protein: oral cancer overexpressed 1
- Target Gene: ORAOV1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000020903 (75%)
- Mouse ENSMUSG00000031072 (75%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)
Recommended Applications
- Immunocytochemistry (ICC)
- Additional applications to be optimized by the user
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.