CacheBy
Atlas Antibodies Anti-ORAOV1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ORAOV1 Antibody

상품 한눈에 보기

Human ORAOV1 단백질을 타깃으로 하는 Rabbit Polyclonal 항체. 면역형광 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며 Rat, Mouse와 75% 상동성 보유. 안정화된 글리세롤 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062696-100 Anti-ORAOV1 Antibody, oral cancer overexpressed 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062696-25 Anti-ORAOV1 Antibody, oral cancer overexpressed 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ORAOV1 Antibody

Anti-ORAOV1 Antibody

Target Protein: oral cancer overexpressed 1 (ORAOV1)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against Human ORAOV1.

Alternative Gene Names

  • TAOS1

Target Information

  • Target Protein: oral cancer overexpressed 1
  • Target Gene: ORAOV1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    GMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000020903 (75%)
  • Mouse ENSMUSG00000031072 (75%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

  • Immunocytochemistry (ICC)
  • Additional applications to be optimized by the user

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.