
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-OFCC1 Antibody
상품 한눈에 보기
Human OFCC1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(재조합 발현) 검증 완료. 고순도 Affinity 정제 항체이며, 인간에 특이적으로 반응. 연구용으로 orofacial cleft 1 candidate 1 단백질 분석에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035725-100 Anti-OFCC1 Antibody, orofacial cleft 1 candidate 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035725-25 Anti-OFCC1 Antibody, orofacial cleft 1 candidate 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-OFCC1 Antibody
Anti-OFCC1 Antibody
Target: Orofacial cleft 1 candidate 1 (OFCC1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation:
Validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human OFCC1.
Alternative Gene Names
- MRDS1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Orofacial cleft 1 candidate 1 |
| Target Gene | OFCC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AEFLMVKEDREATEGTGNPAFNMSSPDLSACQTAEKKVIRHDMPDRTLAAHQQKFRLPASAEPKGNEYGRNY |
Species Reactivity
- Verified species: Human
- Ortholog sequence identity:
- Mouse (ENSMUSG00000047094): 75%
- Rat (ENSRNOG00000059019): 71%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



