CacheBy
Atlas Antibodies Anti-OFCC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-OFCC1 Antibody

상품 한눈에 보기

Human OFCC1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(재조합 발현) 검증 완료. 고순도 Affinity 정제 항체이며, 인간에 특이적으로 반응. 연구용으로 orofacial cleft 1 candidate 1 단백질 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035725-100 Anti-OFCC1 Antibody, orofacial cleft 1 candidate 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035725-25 Anti-OFCC1 Antibody, orofacial cleft 1 candidate 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-OFCC1 Antibody

Anti-OFCC1 Antibody

Target: Orofacial cleft 1 candidate 1 (OFCC1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)

Recombinant expression validation:
Validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against Human OFCC1.


Alternative Gene Names

  • MRDS1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Orofacial cleft 1 candidate 1
Target Gene OFCC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AEFLMVKEDREATEGTGNPAFNMSSPDLSACQTAEKKVIRHDMPDRTLAAHQQKFRLPASAEPKGNEYGRNY

Species Reactivity

  • Verified species: Human
  • Ortholog sequence identity:
    • Mouse (ENSMUSG00000047094): 75%
    • Rat (ENSRNOG00000059019): 71%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.