
Atlas Antibodies Anti-OFCC1 Antibody
상품 한눈에 보기
Human OFCC1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(재조합 발현) 검증 완료. 고순도 Affinity 정제 항체이며, 인간에 특이적으로 반응. 연구용으로 orofacial cleft 1 candidate 1 단백질 분석에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-OFCC1 Antibody
Target: Orofacial cleft 1 candidate 1 (OFCC1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation:
Validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human OFCC1.
Alternative Gene Names
- MRDS1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Orofacial cleft 1 candidate 1 |
| Target Gene | OFCC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AEFLMVKEDREATEGTGNPAFNMSSPDLSACQTAEKKVIRHDMPDRTLAAHQQKFRLPASAEPKGNEYGRNY |
Species Reactivity
- Verified species: Human
- Ortholog sequence identity:
- Mouse (ENSMUSG00000047094): 75%
- Rat (ENSRNOG00000059019): 71%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
