
Atlas Antibodies Anti-NUDT7 Antibody
상품 한눈에 보기
Human NUDT7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, PBS/glycerol buffer에 보존. 사람에 대해 검증되었고, 마우스 및 랫과 높은 서열 유사성을 가짐.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NUDT7 Antibody
Target: nudix (nucleoside diphosphate linked moiety X)-type motif 7
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 연구 응용에 적합
Product Description
Polyclonal Antibody against Human NUDT7
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nudix (nucleoside diphosphate linked moiety X)-type motif 7 |
| Target Gene | NUDT7 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (73%), Rat (68%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 설명 |
|---|---|
| Buffer | PBS (pH 7.2) with 40% glycerol |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NUDT9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUDT8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUDT7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUDT9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NUDT22 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.