CacheBy
Atlas Antibodies Anti-NUDT7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUDT7 Antibody

상품 한눈에 보기

Human NUDT7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, PBS/glycerol buffer에 보존. 사람에 대해 검증되었고, 마우스 및 랫과 높은 서열 유사성을 가짐.

카탈로그번호
HPA042042-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042042-100 Anti-NUDT7 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042042-25 Anti-NUDT7 Antibody, nudix (nucleoside diphosphate linked moiety X)-type motif 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUDT7 Antibody

Anti-NUDT7 Antibody

Target: nudix (nucleoside diphosphate linked moiety X)-type motif 7
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구 응용에 적합


Product Description

Polyclonal Antibody against Human NUDT7
Open Datasheet


Target Information

항목 내용
Target Protein nudix (nucleoside diphosphate linked moiety X)-type motif 7
Target Gene NUDT7
Verified Species Reactivity Human
Interspecies Identity Mouse (73%), Rat (68%)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:
MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTD


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 설명
Buffer PBS (pH 7.2) with 40% glycerol
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

IHC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.