CacheBy
Atlas Antibodies Anti-NUDC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NUDC Antibody

상품 한눈에 보기

Human NUDC 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. 독립 항체 간 비교 검증을 통해 신뢰성 있는 단백질 발현 확인이 가능합니다. PrEST 항원으로 친화 정제되었으며, Human, Mouse, Rat에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA028105-100 Anti-NUDC Antibody, nudC nuclear distribution protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028105-25 Anti-NUDC Antibody, nudC nuclear distribution protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NUDC Antibody

Anti-NUDC Antibody

Target: nudC nuclear distribution protein
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal Antibody against Human NUDC.


Alternative Gene Names

  • NudC

Target Information

항목 내용
Target Protein nudC nuclear distribution protein
Target Gene NUDC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWT
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000051720 (94%), Mouse ENSMUSG00000028851 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.