
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NSRP1 Antibody
상품 한눈에 보기
인간 NSRP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증된 신뢰성 높은 시약으로, siRNA knockdown 및 독립 항체 비교를 통해 유효성 확인. Affinity purified 방식으로 높은 특이성과 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA015603-100 Anti-NSRP1 Antibody, nuclear speckle splicing regulatory protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015603-25 Anti-NSRP1 Antibody, nuclear speckle splicing regulatory protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NSRP1 Antibody
Anti-NSRP1 Antibody
Target: Nuclear speckle splicing regulatory protein 1 (NSRP1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
- ICC: Suitable for immunocytochemistry.
Product Description
Polyclonal antibody against human NSRP1.
Alternative Gene Names
CCDC55, DKFZP434K1421, NSrp70
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Nuclear speckle splicing regulatory protein 1 |
| Target Gene | NSRP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KREVGVQSSERNQDRKESSPNSRAKDKFLDQERSNKMRNMAKDKERNQEKPSNSESSLGAKHRLTEEGQEKGKEQERPPEAVSKFAKRNNEETVM |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000037958 | 68% |
| Rat | ENSRNOG00000022502 | 66% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



