CacheBy
Atlas Antibodies Anti-NSRP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NSRP1 Antibody

상품 한눈에 보기

인간 NSRP1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증된 신뢰성 높은 시약으로, siRNA knockdown 및 독립 항체 비교를 통해 유효성 확인. Affinity purified 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA015603-100 Anti-NSRP1 Antibody, nuclear speckle splicing regulatory protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015603-25 Anti-NSRP1 Antibody, nuclear speckle splicing regulatory protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NSRP1 Antibody

Anti-NSRP1 Antibody

Target: Nuclear speckle splicing regulatory protein 1 (NSRP1)
Supplier: Atlas Antibodies


  • IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Suitable for immunocytochemistry.

Product Description

Polyclonal antibody against human NSRP1.


Alternative Gene Names

CCDC55, DKFZP434K1421, NSrp70

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Nuclear speckle splicing regulatory protein 1
Target Gene NSRP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KREVGVQSSERNQDRKESSPNSRAKDKFLDQERSNKMRNMAKDKERNQEKPSNSESSLGAKHRLTEEGQEKGKEQERPPEAVSKFAKRNNEETVM

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000037958 68%
Rat ENSRNOG00000022502 66%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
IHC Validation Tooltip
WB Genetic Validation
WB Genetic Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.