Atlas Antibodies Anti-NRDC Antibody
상품 한눈에 보기
Human NRDC 단백질을 인식하는 토끼 폴리클로날 항체로, nardilysin convertase 연구에 적합합니다. Affinity purification 방식으로 정제되었으며, 다양한 응용 분야에 사용 가능합니다. Human에 대해 검증된 반응성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NRDC Antibody
Target Protein: nardilysin convertase
Product Description
Polyclonal antibody against Human NRDC.
Also known as nardilysin convertase.
Alternative Gene Names
hNRD1, hNRD2, NRD1
Target Information
- Target Protein: nardilysin convertase
- Target Gene: NRDC
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000053510 (82%)
- Rat ENSRNOG00000007111 (80%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Recommended Applications
ICC (Immunocytochemistry)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.