CacheBy
Atlas Antibodies Anti-NPTXR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPTXR Antibody

상품 한눈에 보기

Human NPTXR 단백질을 인식하는 폴리클로날 래빗 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 RNA-seq 데이터와 비교하여 확인 가능. PrEST 항원으로 정제되었으며, 인간 반응성이 검증됨. PBS/glycerol buffer에 보존 처리된 고품질 항체.

카탈로그번호
HPA001079-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001079-100 Anti-NPTXR Antibody, neuronal pentraxin receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001079-25 Anti-NPTXR Antibody, neuronal pentraxin receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPTXR Antibody

Anti-NPTXR Antibody

Target: Neuronal Pentraxin Receptor (NPTXR)
Type: Polyclonal Antibody against Human NPTXR

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody raised in rabbit against human NPTXR.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Neuronal Pentraxin Receptor
Target Gene NPTXR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016156 (96%), Mouse ENSMUSG00000022421 (95%)

Antigen Sequence:
HHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGILILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWEDKLVEAFGGATKAAFDVC

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.