Atlas Antibodies Anti-NPRL2 Antibody

상품 한눈에 보기

Human NPRL2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Affinity purification 방식으로 정제되었으며, 고순도 IgG 형태입니다. 다양한 종 간 높은 보존성을 보여 신뢰성 있는 검출이 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038196-100 Anti-NPRL2 Antibody, nitrogen permease regulator-like 2 (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038196-25 Anti-NPRL2 Antibody, nitrogen permease regulator-like 2 (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: nitrogen permease regulator-like 2 (S. cerevisiae)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

Polyclonal antibody against Human NPRL2.

NPR2, NPR2L, TUSC4

Target Protein: nitrogen permease regulator-like 2 (S. cerevisiae)
Target Gene: NPRL2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KLIQFGLMKNLIRRLQKYPVRVTREEQSHPARLYTGCHSYDEICCKTGMSYHELDERLENDPNIIICW

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000021660	97%
Mouse	ENSMUSG00000010057	97%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand