CacheBy
Atlas Antibodies Anti-NPPA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NPPA Antibody

상품 한눈에 보기

Human NPPA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 포함한 단백질 발현 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대한 반응성이 검증되었습니다. RNA-seq 데이터 기반 Orthogonal validation 지원.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA064007-100 Anti-NPPA Antibody, natriuretic peptide A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064007-25 Anti-NPPA Antibody, natriuretic peptide A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPPA Antibody

Anti-NPPA Antibody

Natriuretic peptide A

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human NPPA.

Alternative Gene Names

ANP, PND

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Natriuretic peptide A
Target Gene NPPA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWT

Verified Species Reactivity

Human

Interspecies Information

종 유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000041616 81%
Rat ENSRNOG00000008176 78%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.