
원본
Atlas Antibodies Anti-NPSR1 Antibody
상품 한눈에 보기
인간 NPSR1(neuropeptide S receptor 1)을 인식하는 폴리클로날 항체. 토끼에서 유래한 IgG 형식으로 PrEST 항원을 이용해 정제됨. 면역조직화학 등 다양한 응용에 적합하며, 인간 종에 반응. 글리세롤 기반 완충액에 보존됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA007489-100 Anti-NPSR1 Antibody, neuropeptide S receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007489-25 Anti-NPSR1 Antibody, neuropeptide S receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NPSR1 Antibody
Anti-NPSR1 Antibody
Target: neuropeptide S receptor 1 (NPSR1)
Type: Polyclonal Antibody against Human NPSR1
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody targeting human neuropeptide S receptor 1 (NPSR1).
Alternative Gene Names
- GPR154
- GPRA
- PGR14
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | neuropeptide S receptor 1 |
| Target Gene | NPSR1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (87%), Rat (84%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



