CacheBy
Atlas Antibodies Anti-NPSR1 Antibody
원본

Atlas Antibodies Anti-NPSR1 Antibody

상품 한눈에 보기

인간 NPSR1(neuropeptide S receptor 1)을 인식하는 폴리클로날 항체. 토끼에서 유래한 IgG 형식으로 PrEST 항원을 이용해 정제됨. 면역조직화학 등 다양한 응용에 적합하며, 인간 종에 반응. 글리세롤 기반 완충액에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA007489-100 Anti-NPSR1 Antibody, neuropeptide S receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007489-25 Anti-NPSR1 Antibody, neuropeptide S receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NPSR1 Antibody

Anti-NPSR1 Antibody

Target: neuropeptide S receptor 1 (NPSR1)
Type: Polyclonal Antibody against Human NPSR1


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody targeting human neuropeptide S receptor 1 (NPSR1).


Alternative Gene Names

  • GPR154
  • GPRA
  • PGR14

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein neuropeptide S receptor 1
Target Gene NPSR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP
Verified Species Reactivity Human
Interspecies Identity Mouse (87%), Rat (84%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.