CacheBy
Atlas Antibodies Anti-NOL6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NOL6 Antibody

상품 한눈에 보기

인간 NOL6(nucleolar protein 6)을 표적으로 하는 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공. Affinity purification 방식으로 정제되어 안정적이며 40% glycerol/PBS buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA055891-100 Anti-NOL6 Antibody, nucleolar protein 6 (RNA-associated) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055891-25 Anti-NOL6 Antibody, nucleolar protein 6 (RNA-associated) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NOL6 Antibody

Anti-NOL6 Antibody

Target Information

  • Target Protein: Nucleolar protein 6 (RNA-associated)
  • Target Gene: NOL6
  • Alternative Gene Names: bA311H10.1, FLJ21959, MGC14896, MGC14921, MGC20838, Nrap, UTP22
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NOL6.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000010409 (93%)
  • Mouse ENSMUSG00000028430 (91%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications IHC, ICC
Verified Species Reactivity Human
Interspecies Identity Rat (93%), Mouse (91%)

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.