Atlas Antibodies Anti-NOL4L Antibody

상품 한눈에 보기

Human NOL4L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합. RNA-seq 데이터와 비교한 Orthogonal validation 제공. Affinity purification으로 높은 특이성과 재현성 확보. Human 반응성이 검증됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043600-100 Anti-NOL4L Antibody, nucleolar protein 4-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043600-25 Anti-NOL4L Antibody, nucleolar protein 4-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Nucleolar protein 4-like
Supplier: Atlas Antibodies

Immunohistochemistry (IHC) – Orthogonal validation using RNA-seq data comparison between high and low expression tissues
Immunocytochemistry (ICC)

Polyclonal antibody against Human NOL4L.

C20orf112, C20orf113, dJ1184F4.2, dJ1184F4.4, DKFZP566G1424

항목	내용
Target Protein	Nucleolar protein 4-like
Target Gene	NOL4L
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	SDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDDHDDHEDNDKMNDSEGMDPERL
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000061411 (96%), Rat ENSRNOG00000010417 (96%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.