
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NOD2 Antibody
상품 한눈에 보기
Human NOD2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 발현을 확인함. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 버퍼에 보존됨. 인간 시료에 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA041985-100 Anti-NOD2 Antibody, nucleotide-binding oligomerization domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041985-25 Anti-NOD2 Antibody, nucleotide-binding oligomerization domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NOD2 Antibody
Anti-NOD2 Antibody
Target: nucleotide-binding oligomerization domain containing 2 (NOD2)
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human NOD2
Alternative Gene Names
BLAU, CARD15, CD, CLR16.3, IBD1, NLRC2, PSORAS1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | nucleotide-binding oligomerization domain containing 2 |
| Target Gene | NOD2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Mouse Ortholog | ENSMUSG00000055994 (73%) |
| Rat Ortholog | ENSRNOG00000014124 (72%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



