CacheBy
Atlas Antibodies Anti-NOCT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NOCT Antibody

상품 한눈에 보기

인간 NOCT 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대해 검증되었으며, 마우스 및 랫과 높은 서열 유사성을 가집니다.

카탈로그번호
HPA053714-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053714-100 Anti-NOCT Antibody, nocturnin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053714-25 Anti-NOCT Antibody, nocturnin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NOCT Antibody

Anti-NOCT Antibody

Target Information

  • Target Protein: nocturnin
  • Target Gene: NOCT
  • Alternative Gene Names: Ccr4c, CCR4L, CCRN4L, NOC

Product Description

Polyclonal antibody against human NOCT.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

AVTHLKARTGWERFRSAQGCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNSAYKLLSADGQSEPPYTTWKIRTSGECRHTLDYIWYSKHALNVRSALDLLTEEQIGPNRLPSFNYPSDHLSLVCDFSFT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000023087 (96%)
  • Rat ENSRNOG00000010799 (95%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.