
Thermo Fisher Scientific Human IL-8 (CXCL8) (72 aa), Animal-Free Recombinant Protein, PeproTech
인간 IL-8(CXCL8) 재조합 단백질로, 동물 유래 성분이 없는 고순도(≥98%) 제품입니다. 호중구 유인 활성 검증 완료. ELISA 및 기능적 in vitro 실험에 적합. 8.4 kDa, 72개 아미노산으로 구성된 단백질로 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
ELISA
- Tested Dilution: Not specified
- View 1 publication
Functional Assay
- Assay-dependent
- View publication
In vitro Assay
- Tested Dilution: Not specified
- View 4 publications
Product Specifications
| 항목 | 내용 |
|---|---|
| Species | Human |
| Published Species | Bacteria, Human, Mouse |
| Expression System | E. coli |
| Amino Acid Sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCDPKENWVQRVVEKFLKRAENS |
| Molecular Weight | 8.4 kDa |
| Class | Recombinant |
| Type | Protein |
| Purity | ≥ 98% (SDS-PAGE, HPLC) |
| Endotoxin Concentration | < 0.1 EU/µg |
| Activity | Chemoattracts human peripheral blood neutrophils (10–100 ng/ml) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Purification | Purified |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient |
Product Specific Information
Recombinant Human IL-8 (monocyte-derived) is an 8.4 kDa protein containing 72 amino acid residues.
This product is shipped at ambient temperature. For storage, handling, and reconstitution information, please refer to the lot-specific Certificate of Analysis.
Target Information
Interleukin 8 (IL-8, CXCL8) is a 72 amino acid pro-inflammatory factor belonging to the CXC subfamily of chemokines. It binds to IL-8RA and IL-8RB receptors and functions as a chemoattractant and potent angiogenic factor.
IL-8 expression can be induced by various inflammatory stimuli in macrophages and endothelial cells. In endothelial cells, IL-8 is stored in Weibel-Palade bodies.
Originally isolated from osteosarcoma cells, IL-8 contains an ELR-motif (N-terminal Glu-Leu-Arg sequence) and signals through CXCR1 and CXCR2 receptors.
Previous names include NAP-1, GCP-1, MONAP, and protein 3-10C. IL-8 and related chemokines form a gene cluster on chromosome 4q.
IL-8 plays roles in tumor angiogenesis and growth, and in the pathogenesis of bronchiolitis, a viral respiratory disease.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-13, Animal-Free Recombinant Protein, PeproTech
169,200원

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-10, Animal-Free Recombinant Protein, PeproTech
359,800원

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-8 (CXCL8) (72 aa), Animal-Free Recombinant Protein, PeproTech
170,100원

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-13, Animal-Free Recombinant Protein, PeproTech
359,800원

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-11, Animal-Free Recombinant Protein, PeproTech
170,100원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|