Thermo Fisher Scientific Human IL-8 (CXCL8) (72 aa), Animal-Free Recombinant Protein, PeproTech
인간 IL-8(CXCL8) 재조합 단백질로, 동물 유래 성분이 없는 고순도(≥98%) 제품입니다. 호중구 유인 활성 검증 완료. ELISA 및 기능적 in vitro 실험에 적합. 8.4 kDa, 72개 아미노산으로 구성된 단백질로 연구용으로만 사용됩니다.
- 카테고리
- Protein
- 판매단위
- pk
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Human IL-8 (CXCL8) (72 aa), Animal-Free Recombinant Protein, PeproTech
Applications
ELISA
- Tested Dilution: Not specified
- View 1 publication
Functional Assay
- Assay-dependent
- View publication
In vitro Assay
- Tested Dilution: Not specified
- View 4 publications
Product Specifications
| 항목 | 내용 |
|---|---|
| Species | Human |
| Published Species | Bacteria, Human, Mouse |
| Expression System | E. coli |
| Amino Acid Sequence | SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCDPKENWVQRVVEKFLKRAENS |
| Molecular Weight | 8.4 kDa |
| Class | Recombinant |
| Type | Protein |
| Purity | ≥ 98% (SDS-PAGE, HPLC) |
| Endotoxin Concentration | < 0.1 EU/µg |
| Activity | Chemoattracts human peripheral blood neutrophils (10–100 ng/ml) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Purification | Purified |
| Contains | No preservative |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient |
Product Specific Information
Recombinant Human IL-8 (monocyte-derived) is an 8.4 kDa protein containing 72 amino acid residues.
This product is shipped at ambient temperature. For storage, handling, and reconstitution information, please refer to the lot-specific Certificate of Analysis.
Target Information
Interleukin 8 (IL-8, CXCL8) is a 72 amino acid pro-inflammatory factor belonging to the CXC subfamily of chemokines. It binds to IL-8RA and IL-8RB receptors and functions as a chemoattractant and potent angiogenic factor.
IL-8 expression can be induced by various inflammatory stimuli in macrophages and endothelial cells. In endothelial cells, IL-8 is stored in Weibel-Palade bodies.
Originally isolated from osteosarcoma cells, IL-8 contains an ELR-motif (N-terminal Glu-Leu-Arg sequence) and signals through CXCR1 and CXCR2 receptors.
Previous names include NAP-1, GCP-1, MONAP, and protein 3-10C. IL-8 and related chemokines form a gene cluster on chromosome 4q.
IL-8 plays roles in tumor angiogenesis and growth, and in the pathogenesis of bronchiolitis, a viral respiratory disease.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.