CacheBy
Atlas Antibodies Anti-BCORL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BCORL1 Antibody

상품 한눈에 보기

인간 BCORL1 단백질을 인식하는 폴리클로날 항체로, BCL6 corepressor-like 1 단백질 연구에 적합합니다. 토끼에서 생산된 IgG 항체이며, 고순도 친화정제 제품입니다. 인간에 반응하며, 마우스 및 랫과 99% 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA068568-100 Anti-BCORL1 Antibody, BCL6 corepressor-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068568-25 Anti-BCORL1 Antibody, BCL6 corepressor-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BCORL1 Antibody

Anti-BCORL1 Antibody

BCL6 corepressor-like 1

면역조직화학(IHC)

Product Description

Polyclonal Antibody against Human BCORL1

Alternative Gene Names

CXorf10, FLJ11362

Open Datasheet

Target Information

항목 내용
Target Protein BCL6 corepressor-like 1
Target Gene BCORL1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TSCLGSTSSPFVIFPEIVRNGDPSTWVKNSTALISTIPGTYVGVANPVPASLLLNKDPNLGLNRDPRHLPKQEPISIID

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000036959 (99%)
  • Rat ENSRNOG00000005076 (99%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.