
Atlas Antibodies Anti-BCORL1 Antibody
상품 한눈에 보기
인간 BCORL1 단백질을 인식하는 폴리클로날 항체로, BCL6 corepressor-like 1 단백질 연구에 적합합니다. 토끼에서 생산된 IgG 항체이며, 고순도 친화정제 제품입니다. 인간에 반응하며, 마우스 및 랫과 99% 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BCORL1 Antibody
BCL6 corepressor-like 1
Recommended Applications
면역조직화학(IHC)
Product Description
Polyclonal Antibody against Human BCORL1
Alternative Gene Names
CXorf10, FLJ11362
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | BCL6 corepressor-like 1 |
| Target Gene | BCORL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TSCLGSTSSPFVIFPEIVRNGDPSTWVKNSTALISTIPGTYVGVANPVPASLLLNKDPNLGLNRDPRHLPKQEPISIID |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000036959 (99%)
- Rat ENSRNOG00000005076 (99%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BCR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCORL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCORL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCORL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BCOR Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.