CacheBy
Atlas Antibodies Anti-BCKDHB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BCKDHB Antibody

상품 한눈에 보기

Human BCKDHB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 특이 정제되었으며, 높은 종간 보존성을 보입니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031956-100 Anti-BCKDHB Antibody, branched chain keto acid dehydrogenase E1 subunit beta 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031956-25 Anti-BCKDHB Antibody, branched chain keto acid dehydrogenase E1 subunit beta 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BCKDHB Antibody

Anti-BCKDHB Antibody

Target: Branched chain keto acid dehydrogenase E1, beta polypeptide (BCKDHB)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human BCKDHB.
Affinity purified using the PrEST antigen as affinity ligand.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Branched chain keto acid dehydrogenase E1, beta polypeptide
Target Gene BCKDHB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000009928 (92%), Mouse ENSMUSG00000032263 (90%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen as ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적의 조건은 사용자가 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.