
Atlas Antibodies Anti-B3GNT4 Antibody
상품 한눈에 보기
인간 B3GNT4 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 및 면역세포화학(ICC)에 적합합니다. 토끼에서 생산된 IgG 항체이며, 친화 정제되어 높은 특이성과 재현성을 제공합니다. 인간에 반응하며, 글리세롤 기반 완충액에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-B3GNT4 Antibody
Target: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Type: Polyclonal Antibody against Human B3GNT4
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against the human B3GNT4 protein. It is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
- B3GN-T4
- beta3Gn-T4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 |
| Target Gene | B3GNT4 |
| Antigen Sequence | TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (76%), Mouse (74%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-B3GNT6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-B3GNT5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-B3GNT4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-B3GNT3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-B3GNT2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.