
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-B3GNT4 Antibody
상품 한눈에 보기
인간 B3GNT4 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 및 면역세포화학(ICC)에 적합합니다. 토끼에서 생산된 IgG 항체이며, 친화 정제되어 높은 특이성과 재현성을 제공합니다. 인간에 반응하며, 글리세롤 기반 완충액에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA055261-100 Anti-B3GNT4 Antibody, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055261-25 Anti-B3GNT4 Antibody, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-B3GNT4 Antibody
Anti-B3GNT4 Antibody
Target: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Type: Polyclonal Antibody against Human B3GNT4
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against the human B3GNT4 protein. It is affinity purified using the PrEST antigen as the affinity ligand.
Alternative Gene Names
- B3GN-T4
- beta3Gn-T4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 |
| Target Gene | B3GNT4 |
| Antigen Sequence | TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILLEPSGCSKDTFLLLAIK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (76%), Mouse (74%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



