
Atlas Antibodies Anti-ATXN2L Antibody
상품 한눈에 보기
Human ATXN2L 단백질에 대한 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. siRNA 노크다운을 통한 유전적 검증 완료. 토끼 유래 IgG 항체로 PrEST 항원 친화 정제 방식 사용. Human에 대한 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATXN2L Antibody
Target Protein: ataxin 2-like
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Genetic validation by siRNA knockdown
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ATXN2L.
Alternative Gene Names
A2D, A2lp
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
APISASCPEPPIGSAVPTSSASIPVTSSVSDPGVGSISPASPKISLAPTDVKELSTKEPGRTLEPQELARIAGKVPGLQNEQKRFQLEELRK
Verified Species Reactivity
Human
Interspecies Information
| Species | Ortholog ID | Identity (%) |
|---|---|---|
| Rat | ENSRNOG00000018686 | 89% |
| Mouse | ENSMUSG00000032637 | 88% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATXN3L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATXN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATXN2L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATRX Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATXN1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.