
Atlas Antibodies Anti-ATOH8 Antibody
상품 한눈에 보기
Human ATOH8 단백질을 인식하는 토끼 폴리클로날 항체로, bHLH 전사인자 연구에 적합함. PrEST 항원으로 친화 정제되었으며, 인간에 대한 반응성이 검증됨. 면역형광 등 다양한 응용에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATOH8 Antibody
Target: atonal bHLH transcription factor 8 (ATOH8)
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학(ICC) 등 다양한 연구 응용에 적합합니다.
Product Description
Polyclonal Antibody against Human ATOH8
Alternative Gene Names
bHLHa21, FLJ14708, HATH6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | atonal bHLH transcription factor 8 |
| Target Gene | ATOH8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPVPVPVPVPVPYGAPHR |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000037621 | 73% |
| Rat | ENSRNOG00000010716 | 72% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATP13A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATOH1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATOH8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP10A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATP10A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.