
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ATG101 Antibody
상품 한눈에 보기
Human ATG101 단백질을 인식하는 rabbit polyclonal 항체로, 오토파지 관련 연구에 적합. Western blot과 IHC에 사용 가능. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 보존성을 가짐. 안정한 PBS/glycerol buffer로 보관.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039904-100 Anti-ATG101 Antibody, autophagy related 101 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039904-25 Anti-ATG101 Antibody, autophagy related 101 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ATG101 Antibody
Anti-ATG101 Antibody
Target: autophagy related 101 (ATG101)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human ATG101, designed for detection of autophagy related protein 101.
Alternative Gene Names
C12orf44, FLJ11773
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | autophagy related 101 |
| Target Gene | ATG101 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (97%), Rat (96%) |
Antibody Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



