CacheBy
Atlas Antibodies Anti-ATG101 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ATG101 Antibody

상품 한눈에 보기

Human ATG101 단백질을 인식하는 rabbit polyclonal 항체로, 오토파지 관련 연구에 적합. Western blot과 IHC에 사용 가능. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 보존성을 가짐. 안정한 PBS/glycerol buffer로 보관.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039904-100 Anti-ATG101 Antibody, autophagy related 101 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039904-25 Anti-ATG101 Antibody, autophagy related 101 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ATG101 Antibody

Anti-ATG101 Antibody

Target: autophagy related 101 (ATG101)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ATG101, designed for detection of autophagy related protein 101.

Alternative Gene Names

C12orf44, FLJ11773

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein autophagy related 101
Target Gene ATG101
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
Verified Species Reactivity Human
Interspecies Identity Mouse (97%), Rat (96%)

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.