
Atlas Antibodies Anti-ATG101 Antibody
상품 한눈에 보기
Human ATG101 단백질을 인식하는 rabbit polyclonal 항체로, 오토파지 관련 연구에 적합. Western blot과 IHC에 사용 가능. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 보존성을 가짐. 안정한 PBS/glycerol buffer로 보관.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATG101 Antibody
Target: autophagy related 101 (ATG101)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human ATG101, designed for detection of autophagy related protein 101.
Alternative Gene Names
C12orf44, FLJ11773
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | autophagy related 101 |
| Target Gene | ATG101 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (97%), Rat (96%) |
Antibody Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATG2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATG16L2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATG101 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATG10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATF3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.