
Atlas Antibodies Anti-ATE1 Antibody
상품 한눈에 보기
Human ATE1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. PBS/glycerol buffer에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ATE1 Antibody
Target Information
- Target Protein: arginyltransferase 1
- Target Gene: ATE1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPK - Verified Species Reactivity: Human
- Interspecies Information:
- Rat ENSRNOG00000024414 (80%)
- Mouse ENSMUSG00000030850 (70%)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human ATE1
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Storage | Store at recommended temperature; gently mix before use |
| Notes | Optimal concentrations and conditions should be determined by the user |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ATAT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATAD3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATE1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATAD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ATAD3A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.