
원본
Thermo Fisher Scientific PDPK1 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific의 PDPK1 Polyclonal Antibody는 인간, 마우스, 랫트에 반응하는 토끼 유래 IgG 항체로, WB 및 IHC 분석에 사용됩니다. 항원 친화 크로마토그래피로 정제되었으며, 500 µg/mL 농도로 제공되어 대사 연구 및 신호전달 연구에 적합합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오후 11:53
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579801 PDPK1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific PDPK1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human PDPK1 (524–556aa: YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746916 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
PDPK1 (3-Phosphoinositide Dependent Protein Kinase 1)은 AGC 키나아제의 인산화를 매개하며, PKC 및 PKC zeta를 활성화합니다. 또한 PDPK1은 phosphatidylinositol-3,4,5-trisphosphate 존재하에서 Protein Kinase B (PKB)의 threonine 308을 인산화합니다. 활성화된 Akt는 Glycogen Synthase Kinase 3 (GSK3)를 불활성화시켜 글리코겐 합성 효소의 탈인산화 및 활성화를 유도하고 글리코겐 합성을 촉진합니다. PDPK1은 인슐린 유도 글리코겐 합성과 PKC 활성화에 관여하므로 대사성 약물 연구에서 중요한 표적입니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
