CacheBy
Thermo Fisher Scientific MANEA Polyclonal Antibody
원본

Thermo Fisher Scientific MANEA Polyclonal Antibody

상품 한눈에 보기

Human MANEA 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC(P) 및 ICC/IF 실험에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, 비결합형 액상 형태로 제공됩니다. 단기 4°C, 장기 -20°C 보관 권장.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 29. 오후 02:07
Thermo Fisher Scientific PA552781 MANEA Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
773,300원VAT 포함 850,630원

Thermo Fisher Scientific · Thermo Fisher Scientific MANEA Polyclonal Antibody

Applications

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 1:20–1:50

Immunocytochemistry (ICC/IF)

  • Tested Dilution: 0.25–2 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant protein corresponding to Human MANEA. Recombinant protein control fragment (Product #RP-90479).
Conjugate Unconjugated
Form Liquid
Concentration 0.05 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.2, with 40% glycerol
Contains 0.02% sodium azide
Storage Conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2643726

Product Specific Information

  • Immunogen sequence:
    LRPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSETNTKNLKSV EITMKPSKASELNLDEL PPLNNYLHVFYYSWYGNPQFDGKYIHWNHPVLEHWDPRIAKNYPQGRHNPPDDIGSSFYPELGSYSSRD
  • Highest antigen sequence identity to the following orthologs:
    • Mouse: 79%
    • Rat: 76%

Target Information

N-glycosylation of proteins is initiated in the endoplasmic reticulum (ER) by the transfer of the preassembled oligosaccharide glucose-3-mannose-9-N-acetylglucosamine-2 from dolichyl pyrophosphate to acceptor sites on the target protein by an oligosaccharyltransferase complex.
This core oligosaccharide is sequentially processed by several ER glycosidases and by an endomannosidase (E.C. 3.2.1.130), such as MANEA, in the Golgi.
MANEA catalyzes the release of mono-, di-, and triglucosylmannose oligosaccharides by cleaving the alpha-1,2-mannosidic bond that links them to high-mannose glycans (Hamilton et al., 2005).


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.