
Atlas Antibodies Anti-NLRP2 Antibody
상품 한눈에 보기
Human NLRP2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 독립 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 버퍼에 보존. 다양한 응용 실험에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NLRP2 Antibody
NLR family, pyrin domain containing 2
Recommended Applications
- Western Blot (WB)
Independent validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human NLRP2.
Alternative Gene Names
CLR19.9, FLJ20510, NALP2, NBS1, PAN1, PYPAF2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NLR family, pyrin domain containing 2 |
| Target Gene | NLRP2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | EVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVI |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000049759 (30%), Mouse ENSMUSG00000045693 (26%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NLRP12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NLRP11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NLRP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NLRP13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NLRP10 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.