
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NKTR Antibody
상품 한눈에 보기
Human NKTR 단백질을 인식하는 폴리클로날 항체로, 자연살해세포 트리거 수용체 연구에 적합. IHC 및 ICC 응용에 권장. Rabbit 유래 IgG 항체로 PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, 신뢰성 높은 연구용 시약.
- 카탈로그번호
- HPA022120-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA022120-100 Anti-NKTR Antibody, natural killer cell triggering receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022120-25 Anti-NKTR Antibody, natural killer cell triggering receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NKTR Antibody
Anti-NKTR Antibody
Overview
Polyclonal antibody against Human NKTR (natural killer cell triggering receptor), suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This is a polyclonal antibody targeting the natural killer cell triggering receptor (NKTR) in humans.
Alternative Gene Names
- p104
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Natural killer cell triggering receptor |
| Target Gene | NKTR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000049128 (43%), Mouse ENSMUSG00000032525 (42%) |
Antigen Sequence (PrEST):
SSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVEDVLQTDDNMEICTPDRSSPAKVEETSPLGNARLDTPDINIVLKQDMAT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Information | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



