
Atlas Antibodies Anti-NKTR Antibody
상품 한눈에 보기
Human NKTR 단백질을 인식하는 폴리클로날 항체로, 자연살해세포 트리거 수용체 연구에 적합. IHC 및 ICC 응용에 권장. Rabbit 유래 IgG 항체로 PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, 신뢰성 높은 연구용 시약.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NKTR Antibody
Overview
Polyclonal antibody against Human NKTR (natural killer cell triggering receptor), suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This is a polyclonal antibody targeting the natural killer cell triggering receptor (NKTR) in humans.
Alternative Gene Names
- p104
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Natural killer cell triggering receptor |
| Target Gene | NKTR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000049128 (43%), Mouse ENSMUSG00000032525 (42%) |
Antigen Sequence (PrEST):
SSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVEDVLQTDDNMEICTPDRSSPAKVEETSPLGNARLDTPDINIVLKQDMAT
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 항목 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Information | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NKTR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKX2-3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKTR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKX2-4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NKIRAS2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.