CacheBy
Atlas Antibodies Anti-NKTR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NKTR Antibody

상품 한눈에 보기

Human NKTR 단백질을 인식하는 폴리클로날 항체로, 자연살해세포 트리거 수용체 연구에 적합. IHC 및 ICC 응용에 권장. Rabbit 유래 IgG 항체로 PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, 신뢰성 높은 연구용 시약.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA022120-100 Anti-NKTR Antibody, natural killer cell triggering receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022120-25 Anti-NKTR Antibody, natural killer cell triggering receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NKTR Antibody

Anti-NKTR Antibody

Overview

Polyclonal antibody against Human NKTR (natural killer cell triggering receptor), suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This is a polyclonal antibody targeting the natural killer cell triggering receptor (NKTR) in humans.

Alternative Gene Names

  • p104

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Natural killer cell triggering receptor
Target Gene NKTR
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000049128 (43%), Mouse ENSMUSG00000032525 (42%)

Antigen Sequence (PrEST):
SSEEDLSGKHDTVTVSSDLDQFTKDDSKLSISPTALNTEENVACLQNIQHVEESVPNGVEDVLQTDDNMEICTPDRSSPAKVEETSPLGNARLDTPDINIVLKQDMAT

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Information Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.