AI 생성

1 / 2

Atlas Antibodies Anti-NHP2 Antibody

상품 한눈에 보기

Human NHP2 ribonucleoprotein을 타깃으로 하는 폴리클로날 토끼 항체. IHC 및 WB에서 독립 항체 비교를 통한 검증 완료. Human과 Mouse 반응성 확인됨. PrEST 항원으로 친화 정제된 고품질 항체.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044171-100 Anti-NHP2 Antibody, NHP2 ribonucleoprotein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044171-25 Anti-NHP2 Antibody, NHP2 ribonucleoprotein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal Antibody against Human NHP2 ribonucleoprotein

IHC (Immunohistochemistry): 독립적인 항체를 이용하여 서로 다른 에피토프를 타깃으로 한 단백질 발현 검증
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot): 독립적인 항체를 이용하여 서로 다른 에피토프를 타깃으로 한 단백질 발현 검증
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

클론성 (Clonality): Polyclonal
아이소타입 (Isotype): IgG
호스트 (Host): Rabbit
정제 방법 (Purification Method): Affinity purified using the PrEST antigen as affinity ligand

항목	내용
Target Protein	NHP2 ribonucleoprotein
Target Gene	NHP2
Alternative Gene Names	FLJ20479, NOLA2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse
Interspecies Identity	Rat ENSRNOG00000049622 (93%), Mouse ENSMUSG00000001056 (91%)

LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLP

Enhanced Validation
IHC Independent
WB Independent

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.