Atlas Antibodies Anti-NFATC2IP Antibody
상품 옵션 정보 | |||||||
---|---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA053587-100 | Atlas Antibodies HPA053587-100 Anti-NFATC2IP Antibody, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
HPA053587-25 | Atlas Antibodies HPA053587-25 Anti-NFATC2IP Antibody, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-NFATC2IP Antibody
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
Recommended Applications
Product Description
Polyclonal Antibody against Human NFATC2IP
Alternative Gene Names
ESC2, FLJ14639, NIP45, RAD60
Target Protein
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
Target Gene
NFATC2IP
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
SPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVE
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000057384 (69%)
Mouse ENSMUSG00000030722 (67%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|