
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NEURL1B Antibody
상품 한눈에 보기
Human NEURL1B 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC, WB, ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 Rat, Mouse와 91% 서열 동일성.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA037612-100 Anti-NEURL1B Antibody, neuralized E3 ubiquitin protein ligase 1B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037612-25 Anti-NEURL1B Antibody, neuralized E3 ubiquitin protein ligase 1B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NEURL1B Antibody
Anti-NEURL1B Antibody
Target: neuralized E3 ubiquitin protein ligase 1B
Type: Polyclonal Antibody against Human NEURL1B
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human NEURL1B (neuralized E3 ubiquitin protein ligase 1B).
Alternative Gene Names
- DKFZP761M1511
- Neur2
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
ALIDVYGITDEVQLLESAFADTLTPARLSQARFSACLPPSSHDAANFDNNELENNQVVAKLGHL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000027606 | 91% |
| Mouse | ENSMUSG00000034413 | 91% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



