CacheBy
Atlas Antibodies Anti-NEMP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEMP1 Antibody

상품 한눈에 보기

Human NEMP1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Affinity purification 방식으로 정제되었으며, 40% 글리세롤 및 PBS 버퍼에 보존됩니다. 인간에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA014394-100 Anti-NEMP1 Antibody, nuclear envelope integral membrane protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014394-25 Anti-NEMP1 Antibody, nuclear envelope integral membrane protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEMP1 Antibody

Anti-NEMP1 Antibody

Target: Nuclear envelope integral membrane protein 1 (NEMP1)
Supplier: Atlas Antibodies
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human NEMP1, also known as nuclear envelope integral membrane protein 1.

Alternative Gene Names: KIAA0286, TMEM194, TMEM194A
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Nuclear envelope integral membrane protein 1
Target Gene NEMP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (80%), Mouse (79%)

Antigen Sequence:
LCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIYEEASSEEEDSYSRCPAITQNNF


Antibody Properties

항목 내용
Clonality Polyclonal
Host Rabbit
Isotype IgG
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.