CacheBy
Atlas Antibodies Anti-NEK7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEK7 Antibody

상품 한눈에 보기

Human NEK7 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. IHC 등 다양한 응용에 적합하며, 높은 종 간 보존성을 가짐. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015520-100 Anti-NEK7 Antibody, NIMA-related kinase 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015520-25 Anti-NEK7 Antibody, NIMA-related kinase 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEK7 Antibody

Anti-NEK7 Antibody

Target: NIMA-related kinase 7 (NEK7)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human NEK7 protein.

Open Datasheet


Target Information

항목 내용
Target Protein NIMA-related kinase 7
Target Gene NEK7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVAL
Verified Species Reactivity Human
Ortholog Identity Mouse (97%), Rat (97%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.