CacheBy
Atlas Antibodies Anti-NEK5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEK5 Antibody

상품 한눈에 보기

Human NEK5 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 확인함. PrEST 항원으로 친화 정제되었으며 PBS/glycerol buffer에 보존됨. Human, Rat, Mouse 간 교차 반응성 확인.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041399-100 Anti-NEK5 Antibody, NIMA-related kinase 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041399-25 Anti-NEK5 Antibody, NIMA-related kinase 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEK5 Antibody

Anti-NEK5 Antibody

NIMA-related kinase 5


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human NEK5

Open Datasheet


Target Information

항목 내용
Target Protein NIMA-related kinase 5
Target Gene NEK5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ETLTFEDGMKFKEYECVKEHGDYTDKAFEKLHCPEAGFSTQTVAAVGNRRQWDGGAPQTLLQMMAVADITSTCPTGPDSESVLSVSRQEG

Verified Species Reactivity

반응성
Human Verified

Interspecies Information

Highest antigen sequence identity to the following orthologs:

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000048769 59%
Mouse ENSMUSG00000037738 57%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.