CacheBy
Atlas Antibodies Anti-NEK5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEK5 Antibody

상품 한눈에 보기

인간 NEK5 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합합니다. Rabbit 호스트에서 생산되었으며, Affinity purification을 통해 고순도 확보. RNA-seq 데이터 기반 단백질 발현 비교로 신뢰성 높은 검증 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035565-100 Anti-NEK5 Antibody, NIMA-related kinase 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035565-25 Anti-NEK5 Antibody, NIMA-related kinase 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEK5 Antibody

Anti-NEK5 Antibody

NIMA-related kinase 5


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human NEK5
Open Datasheet


Target Information

항목 내용
Target Protein NIMA-related kinase 5
Target Gene NEK5
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ETLTFEDGMKFKEYECVKEHGDYTDKAFEKLHCPEAGFSTQTVAAVGNRRQWDGGAPQTLLQMMAVADITSTCPTGPDSESVLSVSRQEG
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000048769 (59%), Mouse ENSMUSG00000037738 (57%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.